Plant Transcription Factor Database
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla006925
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family HD-ZIP
Protein Properties Length: 752aa    MW: 80599.3 Da    PI: 6.6653
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla006925genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
   Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                +++ +++t++q++eLe++F+++++p++++r eL+++l L++rqVk+WFqNrR+++k
                688999***********************************************999 PP

      START  67 ddkeqWdetla....kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe..sssvvRaellpSgil 153
                d++ +W e+++    + +t++vissg      galqlm aelq+lsplvp R++ f+R+++q+ +g+w++vdvSvd  ++ p+   +s+  +++lpSg++
                56669************************************************************************999999999************** PP

      START 154 iepksnghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                +++++ng+skvtwveh++++++++h+l+r+l++sg+ +ga++wvatlqrqce+
                ***************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007117.2131191IPR001356Homeobox domain
SMARTSM003896.3E-18132195IPR001356Homeobox domain
CDDcd000867.32E-19133191No hitNo description
PfamPF000462.5E-18134189IPR001356Homeobox domain
PROSITE patternPS000270166189IPR017970Homeobox, conserved site
SMARTSM002341.9E-26270484IPR002913START domain
CDDcd088753.41E-85331483No hitNo description
PROSITE profilePS5084830.607333487IPR002913START domain
PfamPF018524.3E-44334484IPR002913START domain
SuperFamilySSF559612.51E-23335484No hitNo description
SuperFamilySSF559611.41E-23512745No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 752 aa     Download sequence    Send to blast
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6819251e-179LN681925.1 Cucumis melo genomic scaffold, anchoredscaffold00052.
GenBankLN7132651e-179LN713265.1 Cucumis melo genomic chromosome, chr_11.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010523041.10.0PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2-like isoform X1
SwissprotA2YR020.0ROC7_ORYSI; Homeobox-leucine zipper protein ROC7
STRINGGSMUA_Achr5P20050_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52170.10.0homeodomain GLABROUS 7